SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006631 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006631
Domain Number 1 Region: 1246-1440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-24
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 28-64,128-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000192
Family G proteins 0.012
Further Details:      
 
Domain Number 3 Region: 423-484
Classification Level Classification E-value
Superfamily FF domain 0.000000589
Family FF domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006631
Domain Number - Region: 479-544
Classification Level Classification E-value
Superfamily FF domain 0.0366
Family FF domain 0.0033
Further Details:      
 
Domain Number - Region: 275-325
Classification Level Classification E-value
Superfamily FF domain 0.0549
Family FF domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006631   Gene: ENSMICG00000007275   Transcript: ENSMICT00000007284
Sequence length 1492
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2603:474733:515865:1 gene:ENSMICG00000007275 transcript:ENSMICT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKRMPEKLNVDGILLCIAVSGCDTKFDDQLKLVNK
LFVQVSSKSTILITATKCDECVDHYLREVQAFASNKKDLVVETSARFNVNIETCFTALVQ
MLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNHPDYE
EYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLNWSEA
LKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQHLISE
KRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQREIVE
KAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESLLLK
HIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFILGKD
GLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFCVFNS
IESLNFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQLANK
LQCPFVDVPTGTYPRKFNETQIKQALRGVLESVKHNLDVMSPVPTNKDVSEADLRIVMCA
MCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITVLSYHSSIGVRK
DELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELMTEG
EHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDV
FLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPVHST
PNCHDHRHKVPPPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKPLFSKAKSCYRRHSDASDDEAFTSKTKRKGRHRGSEEDPLLPVETWKG
GIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYFGMPLQDLVT
AEKPIPLFVEKCVEFIEDTXXXXXXXXXXXXXXXXXXXXXXXXXXXHNINLVSMEVTVNA
VAGALKAFFADLPDPLIPYSLHPELLEAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFF
YNGEIVETTNIVAPPPPSNPGQLESMVPLQLPPPLQPQLIQPQLQTDPLGII
Download sequence
Identical sequences ENSMICP00000006631 ENSMICP00000006631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]