SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006878 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006878
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.02e-51
Family Rhodopsin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006878   Gene: ENSMICG00000007564   Transcript: ENSMICT00000007559
Sequence length 197
Comment pep:novel scaffold:micMur1:scaffold_40930:36227:36817:-1 gene:ENSMICG00000007564 transcript:ENSMICT00000007559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLAVMSYDRYVAICSPLHYSSIMTWKVCVQLATGSWTSGILVSVVDTTFTLRLPYQGSN
SIAHFFCEAPALLILASTDTRTSEMAIFLMGVVILLVPVSLILVSYGHILVTVVKMKSAA
GRLKAFSTCGSHLIVVILFYGSAIINYMTPKSSREHKKLVSVFYTMVTPMLNPLIYSLRN
KDVKGALRKVATRNFPC
Download sequence
Identical sequences ENSMICP00000006878 ENSMICP00000006878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]