SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006961 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006961
Domain Number 1 Region: 56-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-57
Family G proteins 0.0000000133
Further Details:      
 
Domain Number 2 Region: 352-445
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.72e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000021
Further Details:      
 
Domain Number 3 Region: 253-351
Classification Level Classification E-value
Superfamily Translation proteins 1.89e-25
Family Elongation factors 0.00000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006961   Gene: ENSMICG00000007650   Transcript: ENSMICT00000007651
Sequence length 455
Comment pep:known_by_projection scaffold:micMur1:scaffold_21178:4637:8676:-1 gene:ENSMICG00000007650 transcript:ENSMICT00000007651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSTMAAATLLRATPRLSGLSAGPIPLLQGLLRPLKAPALPLLCRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
ANRHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHIV
VYVNKADAVQDSEMVELVELEIRELLNEFGYKGDETPVIVGSALCALEQRDPELGLKSVQ
KLLDAVDTYIPVPTRDLEKPFLLPVETIYSIPGRGTVVTGTLERGILKKGDDCEXXXXXX
XXXTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVY
ILTKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKLTLILRQPMILE
KGQRFTLRDGNRTIGTGLVTDTPAMTEEEKNIKWS
Download sequence
Identical sequences ENSMICP00000006961 ENSMICP00000006961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]