SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007019 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007019
Domain Number 1 Region: 1737-1777,1815-2009
Classification Level Classification E-value
Superfamily Plakin repeat 1.66e-67
Family Plakin repeat 0.00000846
Further Details:      
 
Domain Number 2 Region: 1635-1765
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000497
Family Plakin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007019
Domain Number - Region: 155-225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000198
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number - Region: 306-374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000633
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 696-823,851-878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0378
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number - Region: 638-701
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0912
Family NRPS condensation domain (amide synthase) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007019   Gene: ENSMICG00000007705   Transcript: ENSMICT00000007713
Sequence length 2031
Comment pep:novel genescaffold:micMur1:GeneScaffold_1603:700392:730460:-1 gene:ENSMICG00000007705 transcript:ENSMICT00000007713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGLSKGSQGKGSPKGSPAKGSPKGSPSKHSRAATQELALLISRMQANADQVERDILET
QKRLQQDRLNSEQSQALQHQQETGRSLKEAEVLLKDLFLDVDKARRLKHPQAEEIEKDIK
QLHERVTQECAEYRALYEKMVLPPDVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQVA
EHNILQKEIEAYGQQLRTLVGPDATTIRSQYRDLLKAASWRGQSLGSLYTHLQGCTRQLG
ALAEQQRRIVQQDWSDLMADPAGVRREYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAHQEALKMEWQNFLNLCICQESQLQHVEDYRRFQEEADSVSQTLAKLTSSLDTKY
SPAPGDLSGAPTELLRQLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVQLLRGERYTLVDNADPHTWAVQGPGGETKSAPAACFCIPAPDPEAVARASR
LASELQALKQKLAIVQSRLKASATEAIRPGQQAPAGSASVDPQAQKLLTQMTQLDGDLRQ
IERQVLAWARTPLSRTSPLEDLEGRIHSHKGTAQRLQGLGAEKEAAQQQCEAFLSARPVG
PAALQLPVALNSVKNKHSDVQVLCSLYGEKAKAALGLERQIRDSDRVIGGFESTLAQEAP
VPAAPGLQDRVSQLQHQRRELLGQQACVLGLHRELKAAEHACAALQNNFHEFCQDLPRQQ
RQVRALTDRYHAVGDQLDLREKMLQDVGLTYQQFKNCRDNLSSWLEHLPHNQVRPSDGPS
QIAYKLQAEKRLTQEIQSRDRDRAVASRLSQDLQAALQDYELQADTYRCSLEPSLAVSAP
KKPRVAPLQESIQAQEKDLAKAYTEVVAAHQQQLHQLEFARKMLEKKELSEDIQVTHDAK
QGSESPARAGRESEALKSQLEEERKRVAQVQRELEEQRGQLLQLRTQRPLERLEEKEVVE
FYRDPQLESSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELTELHSKYSAVQKQRPKVQLERVEIFQVD
PETEREIVRLRAQLQEAAGRRSSVEKEVERLLPDLEALRAQKPAVEYKEVTQEVVKHERS
PEVLREIDRLKAQLNELVNAHGRSQEQLIRLQGERDEWKRERAKVETKTVKKEVVRHEKD
PVLEKEAERLRQEVREAAQKRRAAEDAVYELQSKYLLLERRKPEEKVVVQEVVVTQKDPK
LREEHSRLSRSLDEEVGRRRQLELEVQQLRAGVEEKEALLSFGEDRGKKLALERELRQLT
LRIQELEKRPPAVQEKIIMEEVVKLEKDPELERSTEALRRDLDQEKTRVAELHRESKHLQ
VQLDVLQKTKSQEKTIYKEVIRVQKDRALEDERARVWELLSRERAARQAQEEAAGRLRER
IHRAEALGRTWSREEAELQKARDQAGQERGRLQQELRVLERQKQQQALQLQEESKLLSQK
TESERQKATQRGQALSRLEAAILHEKDQIYEKERTLRDLHAKVSREELSQETQTRETNLS
TKICILEPDTGKDMSPYEAYKRGIIDRGQYLQLQELECDWEEVTTSGPCGEESVLLDRKS
GKQYSIEAALRCRRISKEEYHLYKDGHLPISEFALLVAGETKPCSSLSIGSIISKSPLTS
PAPQSTGFFSPSFTLGLGDDSFPIAGVYDTTTDNKCSIKTAVAKNMLDPITGQKLLEAQA
ATGGIVDLLSRERYSVHKAVERGLIDNVSTQRLLNAQKAFTGIEDPVTKKRLSVGEAIQK
GWMPAESALPHLQAQHLTGGLIDPKRTGRIPVPQALLSGMISEELARLLQDESSYEKDLT
DPISKERLSYKEAMGRCRKDPVSGLLLLPAALEGYRCCYRAASPTVPRSLR
Download sequence
Identical sequences ENSMICP00000007019 ENSMICP00000007019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]