SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007092 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007092
Domain Number 1 Region: 40-507
Classification Level Classification E-value
Superfamily Sema domain 1.57e-118
Family Sema domain 0.000041
Further Details:      
 
Domain Number 2 Region: 1349-1478,1674-1861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-49
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 950-1039
Classification Level Classification E-value
Superfamily E set domains 2.33e-18
Family E-set domains of sugar-utilizing enzymes 0.097
Further Details:      
 
Domain Number 4 Region: 1038-1141
Classification Level Classification E-value
Superfamily E set domains 3.82e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 854-951
Classification Level Classification E-value
Superfamily E set domains 0.000000000000712
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1138-1212
Classification Level Classification E-value
Superfamily E set domains 0.00000109
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 8 Region: 806-840
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007092   Gene: ENSMICG00000007782   Transcript: ENSMICT00000007792
Sequence length 1892
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4585:229347:418665:-1 gene:ENSMICG00000007782 transcript:ENSMICT00000007792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IELRGPWPRAAEVDSWSVVLLSVVWVLLAPRAAGMPQFSTFHSESRDWTFNHLTVHRGTG
AVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCGEVLTLTNNVNKLLIID
YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSQGGDG
KLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFD
IFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSVSLPLGWN
RGGVEYRLLQASYLPKPGDSLAQASNISGQDDVLFAIFLKGQKQYHHPPDDSALCAFPIR
AVNLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVEG
LTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSP
ILRDMAFSIDQRFLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRD
KCQRAWEPNRFAASISQCMSLTVRPSSISVSEHSRLLSLVVSDAPDLSAGISCAFGNLTE
VEGQVSGSQVICISPGPKDVPVVPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQL
CLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPIT
LKARNLPQPQSGQRGYECVLSIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDF
AVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSDERRCTLHQHCSSL
SSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPC
TPLPGEYIIAEQIVCEMGHAPVGTASGPVRLCIGECKPEFMAKSHQQYTFVNPSVLSLNP
IRGPESGGTMVTITGHYLGAGSSVAVHLGNQTCEFYGRSMNEIVCVSPPSSNGLGPVPVS
VSVDRARVDNSLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGK
ESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYP
NPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCTVTVSETQLLC
EPPALTGQHKVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFAELQTDINELTSDLDRSGIPYLDYRTYA
MRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLETQRSFSMR
DRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNW
FAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLI
LNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIA
RVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRY
DSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETLFSTVHRGRPLPLAIKYMFDFLDEQADHSIHDTDVRHTWKSNC
LPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAK
DIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSE
ELIGALEQDEQARRQRLAYKVEQLIHAMSLES
Download sequence
Identical sequences ENSMICP00000007092 ENSMICP00000007092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]