SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007187 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007187
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-27
Family SH2 domain 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007187   Gene: ENSMICG00000007898   Transcript: ENSMICT00000007892
Sequence length 128
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4062:23356:39270:1 gene:ENSMICG00000007898 transcript:ENSMICT00000007892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVTVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYIYTYRVSQTE
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIRED
PDACLKAP
Download sequence
Identical sequences A0A2K6FE76
XP_012520291.1.63892 XP_012615019.1.48125 ENSMICP00000007187 ENSMICP00000007187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]