SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007249 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007249
Domain Number 1 Region: 19-208
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007249   Gene: ENSMICG00000007954   Transcript: ENSMICT00000007958
Sequence length 1421
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1263:110772:231997:1 gene:ENSMICG00000007954 transcript:ENSMICT00000007958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMKNKGAKQKLKRKGAAGAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSG
VTSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAV
SHCPEEGQLARIQNVMTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKEIEATG
CNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGALENNXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKLSSKSKKWKSIF
NLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKETKGNFNRTV
TTGGFFIPATKMLPTSTGSSCDLSKQEGEWGQEGMPAGAEGGFDVSSDRSQLQGAQARPP
PEQLKVFRPIEDPESEQTAPKMLGMFYTSNDSASKSVFTSSLFQMEPSPRHQRKALNISE
PFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFQGSESGGWPEEEKPLGAETSA
ASVPKKVVLEDAKPVPEAAGTAECGKGLSLEPGTQLEEKTSEISLGAQHSSELEKRPNPE
NVVEEGREAGGAECSALPESPRARAEAVFLHEMDEDDLANALIWPEIQQELKIIESEEEL
SSLPPPAVTSNPILPILESGPGDFAPPEPPGSFPCGSAPAPVPAPLEEGTRDSTNQTTQG
TSTAANREKLEPELGLRPDPASLAPLEIVPFETVSPQARVEVGAPGNLSPPLPPAPPPPT
PLEEAPRVLLSKGGPEREDPSRNLRTNPYIDPLKFKDSPGIPSLCQGDKAAPRQSEKKNS
KNAAPEGKGSGLPSPTREIEVSPQGERDVAHSVQEPSDCDEDDTATDVAQHGVEMVEPWE
EPQWVTSPLHSPTLKDGHEAQVQGPQDHRLEKRLSHRPSLRQSHSLDSKPTFKSQWTLEA
PSSSSCADLETERNSNPQQPLAPRREIIGWDEKAMRSFREFSGLKGEEALPSQKGPGVMQ
PKPTETSPISHTAGKELGTHLGHSNPPVKQGVVPGPESSEESSSSVQGSTLPEEHPPKLQ
VKSTECGPPKGKNRPSSLNLDSAIPITDLFRFEHVASFSSPGMQQSEPEDPKATWVTSSH
CKADPWRVYSQDPQDLDILAHALTGRRNSAPVSVSAVRTSFMVKMCQARAVPVIPPKIQY
TQIPQPLPSQSSGESGAQSLERSQEEPSPTSGTSEKPAKDDSPSPLESPKGEKPKQNTGA
IKSLPMDATVSCLCEGPTLSPEPGLSNLLSSQDATVQCRKRTSETEPSGDNLLSSKIERP
SEGSKSFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPTQTISPGLLC
GELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQR
Download sequence
Identical sequences ENSMICP00000007249 ENSMICP00000007249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]