SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007312 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007312
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.45e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000343
Further Details:      
 
Domain Number 2 Region: 122-298
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-43
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00055
Further Details:      
 
Domain Number 3 Region: 601-709
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.42e-25
Family Anticodon-binding domain of Class II aaRS 0.0009
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000436
Family TGS domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007312   Gene: ENSMICG00000008016   Transcript: ENSMICT00000008027
Sequence length 718
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3044:87811:102642:1 gene:ENSMICG00000008016 transcript:ENSMICT00000008027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCQRWQLLRLPGLQVCGLHTAAVPTLPHWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKVDAVAWNTTPYQLAQKISSTLADTAVAAQVNGEFYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTERGFYHDFFLGKDRTIRGSELPA
LEQICQELAAAAKPFRRLEASQDQLRQLFKDNPFKLHLIEKKVRGPTATVYGCGTLVDLC
QGPHLRHTGQIGALKLLTNSSSLWKSSGAPETLQRVSGISFPTVELLRAWEAWREKAELK
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTK
LWEQSGHWEHYREDMFALQPPGSDRPASSRSDHPTRLPTDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLGGLTRLWCFQQDDAHIFCAPDQLEAEIRSCLDFLR
SVYAVLGFSFHLALSTRPSGFLGDPCLWDQAEQVLQQALEEFGEPWDLNSGDGAFXGLKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQFKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPFQVVVIPVRTEQEEYAREAQQSLQAAGLASDLDADSGLTLSRKVRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRQLGEWDLTEAVQRLVELQNTRVPNAEEVF
Download sequence
Identical sequences ENSMICP00000007312 ENSMICP00000007312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]