SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007379 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007379
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Sema domain 2.22e-23
Family Sema domain 0.0095
Further Details:      
 
Domain Number 2 Region: 973-1088,1254-1411
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.59e-22
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 541-631
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000105
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.082
Further Details:      
 
Domain Number 4 Region: 458-532
Classification Level Classification E-value
Superfamily E set domains 0.0000000000216
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 112-164
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000824
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 628-665
Classification Level Classification E-value
Superfamily E set domains 0.000011
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007379
Domain Number - Region: 270-309
Classification Level Classification E-value
Superfamily Plexin repeat 0.00419
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007379   Gene: ENSMICG00000008079   Transcript: ENSMICT00000008099
Sequence length 1478
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_594:234400:273626:-1 gene:ENSMICG00000008079 transcript:ENSMICT00000008099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPEQLDCGAAHLQHPLSILQPLKAAPVFRALGLTSVAVAVANNYTAVFLGTVSGRLLKI
NLDESMRVVSRRVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACSAYSTCGD
CVGAADAYCGWCALETRCTLRRDCANSSQQHFWTSASAGPGRCPSMTVLPAEIDVRQEYP
GMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAYCNLLPRDRFPPFPPHQD
HVTVEMSLRVNGQNIVRANFTIYDCSRVGQVYPHTACTSCLSAQWPCFWCTQQHTCVSNR
SRCDASPTPTSPRDCPRTLPAPLAPVSTGGSQDILVPLANAAHFQGTALECSFGLEDTFE
AVWVNESAVRCNQVVLHATQKSQVFPLSLQLKGWPARFLDSPDPMTVEVYNCAMGSPDCS
QCLGREDLGHLCVWSEGCRXXXXXXXXXXXXXXXXXXXIEPLSGPLDGGTLLTIRGRNLG
RRLSDVAHGVWIGGVACEPLAGRYTVSEEIVCATGPAPGPFSDVVTVNASKDGRSRERFS
YVLPLVHSLEPAMGPKAGGTRITILGSDLHVGSELQVLVNDTEPCTELLRTDSSITCTMP
GGALPAAVPVCVRFEHRGCVHGNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMV
QNVSMAAHHIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLT
KELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPTQTLNSQGGSPVQETHPLLGEWK
IPESRRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKEY
YSIMKELLVDLSGASANNPKVMVGTESGGEKKLCNCRSFCETVGEPFFLLLRAIKQQVNK
GSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKI
LEAFCKNVPYSQWPRVEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEG
ASLAMSLIDKKDNTLSRVKDLDTEKYFHLVLPTDELAEPRKSHRQSHRKKVLPEIYLTRL
LSTKGTLQKFLDDLFKAILTIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSL
PLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKE
IPEYRKTVQRYYKQIQDMAPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQ
IMTALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences ENSMICP00000007379 ENSMICP00000007379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]