SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007409 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007409
Domain Number 1 Region: 26-333
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.99e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 320-431
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.6e-18
Family Anticodon-binding domain of Class II aaRS 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007409   Gene: ENSMICG00000008143   Transcript: ENSMICT00000008132
Sequence length 434
Comment pep:known_by_projection scaffold:micMur1:scaffold_54894:6:1310:1 gene:ENSMICG00000008143 transcript:ENSMICT00000008132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRVFQPQNLREDQVLSLEGKASDLTCKSQRLMLQVGLIHPAGPGCYHLLPYTVRAMEKL
VRVIDQEMQAIGGQKVNMPSLSPAELWRATNRWDLMGKELLRLRDRHGKEYCLGPTHEEV
ITALVASQKTLSYKQLPFLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAARQ
TYGLVCDAYCNLFDRLGLQFIKVQADVGSIGGTMSHEFQLPVDVGEDRLAICPRCSFSAN
IETLDLSQRNCPACQGPLTETKGIEVGHTFYLGTKYSSIFNAQFTNIQGKPSLAEMGCYG
LGVTRILAAAIEVLSTEDCIRWPRLLAPYQVCLIPPKKGSKEEAAAELTGHLYDHVTEVV
PQLCGEVLLDDRTHLTIGNRLKDANKFGYPFVIIAGKRALEDPAHFEVRCQNTGEVVFLT
KEGVVELLTQVQTV
Download sequence
Identical sequences ENSMICP00000007409 ENSMICP00000007409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]