SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007422 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007422
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000528
Further Details:      
 
Domain Number 2 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.52e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007422
Domain Number - Region: 98-159
Classification Level Classification E-value
Superfamily SH2 domain 0.000159
Family SH2 domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007422   Gene: ENSMICG00000008142   Transcript: ENSMICT00000008146
Sequence length 468
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_986:255418:547877:1 gene:ENSMICG00000008142 transcript:ENSMICT00000008146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYXXXXXXXXXXXXXXXXXXXVENRPKYYGRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKA
NVTNEEHTSVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISASIYPDINIITGALKLYFRDLP
IPLITYDTYSKFIEAAKISNADERLEAVHEVLLLLPPAHYETLRYLMIHLKKVTMNEKDN
LMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences ENSMICP00000007422 ENSMICP00000007422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]