SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007490 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007490
Domain Number 1 Region: 73-185,212-336
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-50
Family FCH domain 0.011
Further Details:      
 
Domain Number 2 Region: 564-696
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007490   Gene: ENSMICG00000008203   Transcript: ENSMICT00000008221
Sequence length 1080
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4404:59850:353991:1 gene:ENSMICG00000008203 transcript:ENSMICT00000008221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPSRFKKDKEIIAEYESQVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKLAERFMATRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIY
LNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARN
EYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDI
IENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQADLMLRYQQ
LQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLS
KPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRPP
NVPPKPQKHRKSRPRSQYNAKLFNGDLETFVKDSGQVXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDLI
SCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGP
TLMPVPEIQDQVSCQAHVNEIVKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYSE
HGTLEEVDQDAGTEPHTSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHS
DGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPNLASHPRGLLQNRG
LNNDSPERAGHGSLTISRHDSLKKMDSPPIRRSTSSGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXERQSTAERAPDVVLDTLEQVKNSPIPATSTESLSPLHNVTLRSSEPQIR
RSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPSQGPADKSCTM
Download sequence
Identical sequences ENSMICP00000007490 ENSMICP00000007490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]