SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007641 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007641
Domain Number 1 Region: 523-555,632-677
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007641   Gene: ENSMICG00000008387   Transcript: ENSMICT00000008391
Sequence length 677
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_970:87090:122930:-1 gene:ENSMICG00000008387 transcript:ENSMICT00000008391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHKKDKVSDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTFVSLLG
DYGLITAVIIALMTVIYRTQPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIY
YANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANVANATVVKAVMDAEVDGED
GTKPEEEDGEVKYPPIVIKSTFPEELQRFMPPGDNVHTVILDFTQVNFIDSVGVKTLAGI
VKEYGDVGIYVYLAGCS
Download sequence
Identical sequences ENSMICP00000007641 ENSMICP00000007641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]