SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007666 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007666
Domain Number 1 Region: 32-290,389-461
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-77
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000474
Further Details:      
 
Domain Number 2 Region: 267-385
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5.83e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 
Domain Number 3 Region: 480-531
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.000000017
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007666   Gene: ENSMICG00000008421   Transcript: ENSMICT00000008417
Sequence length 531
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4115:58787:77565:1 gene:ENSMICG00000008421 transcript:ENSMICT00000008417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAAFQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLS
EAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHY
MTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLL
HTLYGRSLRYDTSYFVEYFALDLLMENGECCGVIALCIEDGSIHRIRAKNTVIATGGYGR
TYFSCTSAHTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQG
ERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAMRLPGI
SETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNHKGQVLKHVNGQDQVVPGLYACGEAAC
ASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPSIKPNAGEESVMNLDKLRFAD
GSIRTSELRLNMQKSMQSHAAVFRLGSVLQEGCEKISQLYGDLKHLKTFDR
Download sequence
Identical sequences ENSMICP00000007666 ENSMICP00000007666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]