SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007674 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007674
Domain Number 1 Region: 22-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007674
Domain Number - Region: 168-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00181
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007674   Gene: ENSMICG00000008430   Transcript: ENSMICT00000008425
Sequence length 251
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2323:404663:415012:1 gene:ENSMICG00000008430 transcript:ENSMICT00000008425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFRFVCCLVVVWLISASDAESCSEPPPVNNSIFVAKEVEGQILGTYLCIKGYHLVGEKT
LSCNASKEWSGPTAKCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRLVGTQDQRCV
DGEWSSALPSCEAPKPAPRTALEKALLAFQENKDLCKATEDFMQRLKECNLTMEELKYSL
EWKKAELKGKM
Download sequence
Identical sequences ENSMICP00000007674 ENSMICP00000007674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]