SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007675 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007675
Domain Number 1 Region: 80-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 137-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000401
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 222-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000051
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007675
Domain Number - Region: 272-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00219
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007675   Gene: ENSMICG00000008429   Transcript: ENSMICT00000008426
Sequence length 438
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3448:1539476:1584434:1 gene:ENSMICG00000008429 transcript:ENSMICT00000008426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPNSLRALFLLLLLLACPESSRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMK
SRLAALQSSVSRVAPDAPPVSCPALNAPPDGKKFGSKYLVDHEVHFTCNPGFRLVGPSSV
VCLPNGTWTGEQPRCRDISECSSQPCQNGGTCVEGVNQYRCICPPGRTGSRCQHQAQTAA
PEGSVGGDPAFSRAPRCAQVERAQHCSEAGFHLRGAAGDSVYDVNECEIYGQEGRPRLCM
HACVNTPGSYRCTCPSGYQTLADGKSCEDVDECMGPQHVCPQGTTCINTGGGFQCVSPEC
PEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKPPITLFRMATAS
APGRPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLQGPQTLEVDVDMSEYLDRS
FQANHVSKVTIFVSPYDF
Download sequence
Identical sequences ENSMICP00000007675 ENSMICP00000007675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]