SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007698 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007698
Domain Number 1 Region: 559-612
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000863
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 420-482
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000001
Family BCR-homology GTPase activation domain (BH-domain) 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000007698
Domain Number - Region: 332-360
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00144
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007698   Gene: ENSMICG00000008439   Transcript: ENSMICT00000008453
Sequence length 654
Comment pep:novel genescaffold:micMur1:GeneScaffold_4206:1855:83977:1 gene:ENSMICG00000008439 transcript:ENSMICT00000008453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRF
YEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKEPSVRQLALLHFRNAITLSVKLEDA
LARAHARVPPAIVQMLLVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXCILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQLAGDDGF
GRQVLTFSCCRMPPSHELNHQRLLXXXXXXXXXXXXXXXXXXXXXXGLDSRNKPSLSWLQ
SAYEEFDRPRQALNSGLKGCSCLSLPXXXXXXYKKNLKALYVVHPTSFIKVLWNVFRPLI
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDEKLRSLHQGRPPPAMKTPPPRPPL
PTQQFGVSLQYLKDKNRGELIPPVLRSTVTYLREKGRTEGLFRRSASVATVREIQRLYNQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVSRESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNLF
TELLIEYYEKVFVAPEAPRGEQVRRAAPSPPGGVRQAGHTRPSPSPPMAARRPR
Download sequence
Identical sequences ENSMICP00000007698 ENSMICP00000007698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]