SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007786 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007786
Domain Number 1 Region: 325-530
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-49
Family p120GAP domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 119-160
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000327
Family Synaptotagmin-like (S variant) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007786   Gene: ENSMICG00000008546   Transcript: ENSMICT00000008548
Sequence length 723
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_608:299045:322696:-1 gene:ENSMICG00000008546 transcript:ENSMICT00000008548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HDDVIGKISLSREAIAADPRGIDSWVNLSRVDRDSEVQGEVRLSVQVLEDARGRCLRCHV
LQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVE
LWDWDMVGKNDFLGMVEFSPRTLRHRPPDGWFRLLPFPGAEEDSGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRISFKGAPSEEQLRETSLGLLTGYLGAIVDAIVGSVGRCPLAMRL
AFRQLRRRVQERFPQAERQDVKYLAISGFLFLRFFAPAILTPKLFDLRDHHADPQTSRSL
LLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQSISRVRDFLDRLVDVDGDEAGAPARA
LVPPSATLREGYLLKRKEEPASLAPRFAFKKRYFWLSGETLSYAKGPEWQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXAGCSRTHSAVTLGDWSDPLDPDAEAQMVYRQLLLGRDQ
LRMQALGDASAAMTLEADACPDVLARQRAAAARLLEVLADLDQAHEDFQLQEQGRAAPGH
RRP
Download sequence
Identical sequences ENSMICP00000007786 ENSMICP00000007786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]