SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007808 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000007808
Domain Number - Region: 372-427
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0249
Family Transglutaminase, two C-terminal domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007808   Gene: ENSMICG00000008568   Transcript: ENSMICT00000008570
Sequence length 625
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4140:804:6653:-1 gene:ENSMICG00000008568 transcript:ENSMICT00000008570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGVPGKPADPCFLPVLCCVSPASRVPHGHLWGSGSFTLKEALFGLLFGADATLLESPVI
LCGLPDGQLCSVVLKALVTSRSAPGDPKALVKILHHLEEPVIFIGALRTEPQAEEAAEEM
PPGEDVHSDCLVALGHYGRTLAIKASWDKAGNLVPELREYCLPGPVLCAACGGGGRVYHS
TPSDLCMVDLARGSTPSDPTQPEEGPGGLPPLLCPASLSACSVVTLSVSSRAPEGDTELL
ALSAKGRLMTFSLDLNSEVPGLSAVSRADTGQKIKELLSGIGNVSERVSFLKKAVDQRNK
ALTSLNEAMNVSCALLSSREGPRPISCTTTAAWSRLQMQDVLTATCLLENRSAFHLGQGW
TLCVQVLTSCSALDLDSAGAATTYTIPVDQLGPGGQREVTLPLGPGENGSFDLPVTVSCT
LFYSLREVVGRALAPSDSFEEPFLDEEPPDVLPEQEGICLPLNRHTVDLLQSLRFPGLAP
PCTQAPPLGGPGSVDTLLKTRKPRSQPVEPASRTRPTPPADPAGHSVGPLWKHVGDPGLP
LCCATLRWLLAENAAADVVRARALSSVQGVAPDGADVHLIAPPVLQVAVTDLCLAGPIQV
VEIQVESSSLADVCRAHHAVIGRMQ
Download sequence
Identical sequences ENSMICP00000007808 ENSMICP00000007808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]