SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007815 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007815
Domain Number 1 Region: 265-371
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 514-620
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 3 Region: 394-506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 4 Region: 109-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-24
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 631-676
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000877
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007815   Gene: ENSMICG00000008572   Transcript: ENSMICT00000008578
Sequence length 678
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4033:35371:106474:1 gene:ENSMICG00000008572 transcript:ENSMICT00000008578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYRRDAAGFRGGPWKGRPERSAVQGTSVTQQEGESQPDSPRGLEEECLFIAVLPAAVSTQ
LSPTTAARSAPPVLPVADSVSAGRRANVPGPCLSGKQLLKCNTFLHLEKFPCGGIITNSS
GAIRNPPQNEMHDNITCVWEIKANATDHVLLAFPYLNLDCTNEYFEILDGPPASAQSLGK
TCSGFYLTYASSSSSMTLAYFRSINNIGKNFLAYYYSAPKGKNGGHLLVSTAIPTATPKT
VTARPGKPNASVRLGSQTTSLSAGDWPELRLVGGSGRCSGRVEVLHQGAWGTVCDDLWDL
NEAEVVCRQLRCGWAVSSPGEAHFGPGSGDIFLDNMQCSGVEHYLGQCAHSGWSEHNCGH
HEDAGVICSGTFSPHSDADDLPLPTPPVSGGSNSCGGVISSLSGSFSSPRYPENYPTDVQ
CVWEIHVDKKFLIELIIPNLKLEDILGCPYDSIEIFDGPRIASLSMGKFCGLAAVIFFSS
SNIMTVVFQSDSVITNTGFYALFNAIPLGERESEDGPLRLVGGSGWCSGYVAVLHQGAWG
TVYDDPWDLSEAKVVRRQLGCGWAIADPGKGHGPGSGDIFLHNSRCSGSEKRLGLCPSSG
WSDHNCGHHKDAGIICSAVRLASASTGGSNPCGGVISSLSGSFSSPWYPTHYPTNTECVW
VIRVADEFRIELTIPSLK
Download sequence
Identical sequences ENSMICP00000007815 ENSMICP00000007815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]