SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000007981 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000007981
Domain Number 1 Region: 240-343
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.58e-45
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000289
Further Details:      
 
Domain Number 2 Region: 145-275
Classification Level Classification E-value
Superfamily Translation proteins 4.57e-36
Family Elongation factors 0.00000468
Further Details:      
 
Domain Number 3 Region: 1-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.38e-34
Family G proteins 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000007981   Gene: ENSMICG00000008770   Transcript: ENSMICT00000008765
Sequence length 364
Comment pep:novel scaffold:micMur1:scaffold_121109:214:1308:-1 gene:ENSMICG00000008770 transcript:ENSMICT00000008765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDST
EPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTR
KDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVV
TFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAA
GFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFPELKEKIDRRSGKKLEDGPKFLKSGD
AAIIDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKA
QKAK
Download sequence
Identical sequences ENSMICP00000007981 ENSMICP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]