SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008246 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008246
Domain Number 1 Region: 752-979
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-58
Family DBL homology domain (DH-domain) 0.000000000928
Further Details:      
 
Domain Number 2 Region: 983-1114
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-37
Family Pleckstrin-homology domain (PH domain) 0.000000599
Further Details:      
 
Domain Number 3 Region: 350-428
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.66e-27
Family Regulator of G-protein signaling, RGS 0.00000949
Further Details:      
 
Domain Number 4 Region: 37-121
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000008246
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0102
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008246   Gene: ENSMICG00000009042   Transcript: ENSMICT00000009054
Sequence length 1556
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2312:236211:356148:-1 gene:ENSMICG00000009042 transcript:ENSMICT00000009054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDTSETAGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPSPAGAPRVTPVVPPPPPPPPLPPPERITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLY
GDTNQRPSEGRFSLDSREGDSGLDSGTERFSSLSESLMNRNSVLSDPGLDSPQTSPVIMA
RVAQHHRRQGSDAPVPTTSDQGVDQSLKPLIIGPEEDYDPGYFNNESDVIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCVEVYQQTNPKESRSLGKDIWNIFLDKNAPLRVKIP
EMLQAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSNHKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKP
GNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMK
RSRKSENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIES
PSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGRDVVAGLTQREIDRQEVINEL
FVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREE
GPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQXAES
HPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYVNE
AVKQTENRHRLEGYQKRLDATALERASHPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTL
DLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRA
FFIICTSKGSPQIYELATSSXXXXWMELLEEAVRNATRHPGAAPTPIHPLPPGRQEPAHQ
GPTPSRVGLDDSEVFHSGPEPEELPGGTEPQQRVQGKHPVLLEDPEQEGSVEEEELGVLP
HPSASLDEENRGTLRRAPIHLALPGPLFMEGLADSALEDVENLRHLILWSLLPGHATETQ
ATGEPEDDLTPTPSVISITSHPWDPGSPGRAPPGGEGDGTQLPGPEAGPEQEDVALSSLG
HLPPRTRNSGIWESPELDRNLTQEASSTEAAGSYKVVRKAEVAGSKVVPALPESGQSEPE
PPEVEGGTKATGNCFYVSMPAGPLDSSTEPSGAPISPSQPDSLPAWQTEPRPQQWGGSGD
QRRPSRSFPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGTTPVGS
FHTEAARWTDNSLSSPAKEPLASDSRNSHELGPCPEDGSDTPLEDSTADTSSSPGL
Download sequence
Identical sequences ENSMICP00000008246 ENSMICP00000008246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]