SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008274 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008274
Domain Number 1 Region: 382-788
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.24e-106
Family Phosphofructokinase 0.00000811
Further Details:      
 
Domain Number 2 Region: 56-380
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.15e-102
Family Phosphofructokinase 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008274   Gene: ENSMICG00000009077   Transcript: ENSMICT00000009086
Sequence length 821
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_23:548563:587177:1 gene:ENSMICG00000009077 transcript:ENSMICT00000009086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEASTSSMLLPKPPRKTDDLKSLDTIGDPDIMADIPIIKTEWIMTHEEHHAAKTLGIGKA
IAVLYGGDAHGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATWESVSMMLQ
LGGTVIGSARCKDFRDREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSD
LQKAGKITAEEVTKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQS
HQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRIRGSRLN
IIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGV
EAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMEEKKFDEAMKLRGRSF
MNNWEVYKLLAHVRPPVSKTVSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHD
GFQGLAGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFDQISANITKFNIQGLIIIGGF
EAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADTALNTICTTCDRIKQS
AAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTT
VKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKM
GAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQPVTELKDQTDFEHRIPKE
QWWLKLRPILKILAKYEIDLDTSEHAHLEHITRKRSGDAAV
Download sequence
Identical sequences ENSMICP00000008274 ENSMICP00000008274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]