SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008302 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008302
Domain Number 1 Region: 23-282
Classification Level Classification E-value
Superfamily DNase I-like 4.97e-44
Family DNase I-like 0.00000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008302   Gene: ENSMICG00000009117   Transcript: ENSMICT00000009117
Sequence length 283
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_862:142279:144878:1 gene:ENSMICG00000009117 transcript:ENSMICT00000009117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGMRLLGGLLALAGLLQVVPSLRIAAFNIRTFGETKMSNATLSNYIVQILSRYDIALVQ
EVRDSHLTAVGKLLDKLNQDTPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSVLDSYYYD
DGCEPCGNDTFSREPAIVKFSSPFTEVREFAIVPLHAAPTDAVAEIDALYDVYLDVRQKW
DMEDIMLMGDFNAGCSYVTPSQWPSIRLRTNSAFQWLIPDSADTTVTSTHCAYDRIVVSG
SLLQGAVVPGSAAPFDFQTTYGLSEELALAVSDHYPVEVTLKK
Download sequence
Identical sequences ENSMICP00000008302 ENSMICP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]