SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008434 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008434
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-121
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000597
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000008434
Domain Number - Region: 369-429
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000118
Family Anticodon-binding domain of Class II aaRS 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008434   Gene: ENSMICG00000009263   Transcript: ENSMICT00000009260
Sequence length 430
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4021:139507:152537:-1 gene:ENSMICG00000009263 transcript:ENSMICT00000009260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSHAAVRACHKVCRCLLSGFGGRVGGGQPEQLTESGISRGGHLGSHAELHRGSEPTEAP
GSGEGSEELLEICQRRHFLSGTKRQLSRDSLLSGCHPGFGPLGIELRKNLASEWWSSVVV
FREQVFPVDALHHEPGPSLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENLLKTSGK
LRENLFHGALEHYVNCLELVNKRLPYGLAQIGVCFHPVSDTRQIPNDVKRIGEKTEASLV
WFTSPRTSSQWLDFWLRHRLLWWRKFAVSPSNFSSSDCQDEEGRKGNKLYYNFPWRKEPI
ETLWNLGDNELLHMYPGNVSKLHGRDGRKNVVPCVLSINGDLDRGMLAYLYDAFQLTENS
FTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTGELRQVCQRDINELLENEISVWPGYLET
VPSSLEQLYS
Download sequence
Identical sequences ENSMICP00000008434 ENSMICP00000008434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]