SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008541 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008541
Domain Number 1 Region: 49-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.11e-42
Family G proteins 0.000000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008541   Gene: ENSMICG00000009383   Transcript: ENSMICT00000009381
Sequence length 190
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3079:109875:139215:1 gene:ENSMICG00000009383 transcript:ENSMICT00000009381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGATRPNGNTGNKICQFLVLLGSAVSLVLRXXXXXXXXXXXXXXXXAFLTQTVCLDD
TTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNI
VIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEP
QNPGANSARG
Download sequence
Identical sequences ENSMICP00000008541 ENSMICP00000008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]