SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008544 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008544
Domain Number 1 Region: 655-846
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000832
Further Details:      
 
Domain Number 2 Region: 72-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 503-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000405
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Domain Number 4 Region: 300-358
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000008
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008544   Gene: ENSMICG00000009381   Transcript: ENSMICT00000009386
Sequence length 859
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2233:444681:584410:-1 gene:ENSMICG00000009381 transcript:ENSMICT00000009386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGADDYDAEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARSQGGGDSISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHNAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTTEPKWDEEFEIELEGSQSLRILCYDKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERSKV
PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK
RVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
PPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSMICP00000008544 ENSMICP00000008544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]