SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008640 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008640
Domain Number 1 Region: 711-913
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-55
Family p120GAP domain-like 0.00000000411
Further Details:      
 
Domain Number 2 Region: 589-725
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.35e-17
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 274-333
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000394
Family SH3-domain 0.002
Further Details:      
 
Domain Number 4 Region: 530-580
Classification Level Classification E-value
Superfamily PH domain-like 0.0000266
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008640   Gene: ENSMICG00000009491   Transcript: ENSMICT00000009496
Sequence length 1040
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2421:10734:102175:1 gene:ENSMICG00000009491 transcript:ENSMICT00000009496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGGEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPLAAAPYPGLVEAGVAGT
LGSGAALGSGFLGAGSVAGALGGAGLTGGGAAAGVAGAAAAGPSGEMALTKLTTSLPAET
LGPGGGFPPLPPPPPLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDRRRVRAILPYTKVPDTDEISFLKGDMF
IVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDQEQVLNDALDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNCFQIVVQH
FSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLP
VKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKD
PDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFK
ELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTL
FRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLAH
LLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICP
AILNPRMFNIISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFLDELGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVLKKLL
AITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences ENSMICP00000008640 ENSMICP00000008640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]