SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008668 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008668
Domain Number 1 Region: 72-272
Classification Level Classification E-value
Superfamily Translation proteins 5.74e-43
Family Ribosomal protein L3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008668   Gene: ENSMICG00000009524   Transcript: ENSMICT00000009524
Sequence length 348
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1264:12179:55753:-1 gene:ENSMICG00000009524 transcript:ENSMICT00000009524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWRLLTQAGAQVLGRGSGCLGAAPGSGNRTNIWLFVRNLHGKSGTWWDEHLSEENVPF
VKQLVSDEDKAQLASKLCPLKDEPWPIQPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVT
LLQVQDCHVIKYTSKENHNGKMAALHVGGKTVSRFRKPTSVLEFYRELGLPPKQKVKIFH
VTDNAVIKPXXXXXXXXXXXXXXXXXXXXXIGKGFQGVMKRWGFKGQPATHGQTKTHRRP
GAISTGDVARVWPGTKMPGRMGNVDRTTYGLKXXXXXXXXXXXXXXXXXXXXXXXXXXVR
DSNLPAYKDFCKNLPFPTYFPDGDEEELPEDLYDENVWQSSEPSITFA
Download sequence
Identical sequences ENSMICP00000008668 ENSMICP00000008668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]