SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008756 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008756
Domain Number 1 Region: 571-678
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000975
Further Details:      
 
Domain Number 2 Region: 307-379
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00039
Further Details:      
 
Domain Number 3 Region: 9-40
Classification Level Classification E-value
Superfamily SRCR-like 0.0000719
Family Scavenger receptor cysteine-rich (SRCR) domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008756   Gene: ENSMICG00000009616   Transcript: ENSMICT00000009620
Sequence length 731
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3889:492:11921:1 gene:ENSMICG00000009616 transcript:ENSMICT00000009620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVGIQAVERLRLADGPHGCAGRLQHGGRGTVCDDGWDLXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPLGYVPPTAPAVDSNTSTSRQVVS
RPLSPTVSQAQGTAGISPPPASPTAPREPGPEAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXDMRDSAVVCRELGCPQQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSDCPAAP
WGKHNCAHNEDVGVTCTGPPGLDSVSDPFSWSWIPGLGRDQDTWLPGEMVTKPSATLTST
VPEKTTTKAPGKMPKSTKKWVTKNAKRPTTHPPVTPTTKHSRGLGTQRPPALTSRTTATS
EFTTRLTTEAPHRHTSHTTATLTSQGPRERTSKTMAMLTTQGPQEMTSETPIKRIPQASL
EPSAEIPAEGSPESPKEPGPTPTASTTEQSGLFRVRLADGPNRCAGRLEVWHAGRWGTVC
DDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEASLSDCPSGPWG
KHNCDHEEDVGLTCTGYTDEDDYPPWTWDPTSGEDLAKGTTVAGVPGRTLSWGTTRRPGV
SSLATWHLPVT
Download sequence
Identical sequences ENSMICP00000008756 ENSMICP00000008756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]