SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009004 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009004
Domain Number 1 Region: 214-418
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009004   Gene: ENSMICG00000009879   Transcript: ENSMICT00000009886
Sequence length 570
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_595:211499:267356:1 gene:ENSMICG00000009879 transcript:ENSMICT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKNKQSVRDVRDIFGVNESXPGNTCDNHTLQLDGTQEGKEPPGVIQTSGPKPGGVSLN
STTLSDTSQVEEESFAVPRSGSVSILETIPDIPVHSNGSPDPGQPVQNAMSDNDYLEKNI
PPEAEELSFEVSYSEMVTEAPKRNKLKKSEIKKEDYALTKLIVQKTRSGLTEAGDLSAED
MKKIRHLSLIELTAFFDAFGIQLKRNKTEKVKGRDSGIFGVPLTVLLENDRRKDPGVKVP
LVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAKFNADKFKWDKMCHREAAVML
KAFFRELPTSLFPVEYIPAFITLLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXALMTFFN
KVIANESKNRMSMWNISTVMAPNLFFSRSKHSDYEELLLASTAAHIIRLMLKYQKILWKV
PSFLITQVRRMNEATMLLKKQLPSVRKLLRRKTIEREITSPKTSKVLQKSPSSRRMSDVP
EGVIRVHAPLLSKVSMAIQLNSQTKAKDILAKFQFENSRGSSECIKIQNQRLYEIGGNIG
QHCLDPDAYILDVYHANPQAEWVIKPQASP
Download sequence
Identical sequences ENSMICP00000009004 ENSMICP00000009004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]