SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009064 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009064
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.75e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009064   Gene: ENSMICG00000009953   Transcript: ENSMICT00000009951
Sequence length 228
Comment pep:novel genescaffold:micMur1:GeneScaffold_452:509974:526007:1 gene:ENSMICG00000009953 transcript:ENSMICT00000009951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVARPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences ENSMICP00000009064 XP_012606912.1.48125 ENSMICP00000009064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]