SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009075 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009075
Domain Number 1 Region: 173-480
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.29e-80
Family Transglutaminase core 0.000000658
Further Details:      
 
Domain Number 2 Region: 22-171
Classification Level Classification E-value
Superfamily E set domains 1.33e-43
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 500-612
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-27
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 
Domain Number 4 Region: 614-712
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.15e-26
Family Transglutaminase, two C-terminal domains 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009075   Gene: ENSMICG00000009962   Transcript: ENSMICT00000009962
Sequence length 715
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4842:84815:105977:-1 gene:ENSMICG00000009962 transcript:ENSMICT00000009962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGEPSQISLELPGLSVASGSLYVFHKGSGMLGIKSCDFQAARNNEEHHTRAISSQRLI
VRRGQPFTIILHFRVPVRAFLPALKKVNLVAQTGEQPSKDNRTQATFPISRLGDTKWWSA
VVMERDTQSCTISVTTPVDAVIGHYSLLLQVSSKRQHLLGQFTLLFNPWGREDAVFLGNE
AQRREYLLNQNGLIYLGTADCIQAESWDFGQFEGDVMDLSLGLLSVDKQVAEWSQPVHVA
RVVGALLRTLKEKCVLPTPQSQDAQERALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLA
AVACTVLRCLGVPARVVTTFGSAQGTGGDLLVDEYYNEEGLQNGEGQRGGIWIFQTATEC
WMTRPALPRAYDGWQILHPSAPSGEVPGFCDLVPVRAVKEGTLGLTPAVPDLFAAVNASC
VVWKCCEDGTLELTDSNTKYVGNNISTKGVGGDRCEDITQNYKYPEGSLQEKEVLERVQK
ERMKHGKDNDIHLPHPESADPLYLFLEAPSSLPLRGDAQLSVILVNPSDQEKVVRLAIAV
QAVHYNGVLAAKLWREKLSLTLSANLVKRITTSLSFSYFEQNPPENSFLRLTAVATHSES
CLSCFAQEDIAICKPRLAIEMPEKAEQYQPLKASVSIHNSLDAPMKDCVISIRGKGLIYR
DRSYRLGSVRPGNTVCTQFQFTPTHVGFQRLTVEVDCNMFQNLTNYRSVTVVAPE
Download sequence
Identical sequences ENSMICP00000009075 ENSMICP00000009075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]