SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009103 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009103
Domain Number 1 Region: 146-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.62e-108
Family Transglutaminase core 0.0000000225
Further Details:      
 
Domain Number 2 Region: 3-145
Classification Level Classification E-value
Superfamily E set domains 1.08e-40
Family Transglutaminase N-terminal domain 0.00029
Further Details:      
 
Domain Number 3 Region: 612-710
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.12e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 499-610
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-26
Family Transglutaminase, two C-terminal domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009103   Gene: ENSMICG00000009975   Transcript: ENSMICT00000009994
Sequence length 713
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4842:112858:143389:-1 gene:ENSMICG00000009975 transcript:ENSMICT00000009994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVVLTDFQSSRNNLRHHTQEISVDRLVVRRGQAFRITLYFRNRGFQPGLDNIIFM
TETGPLPDQTKGTQAMFSLTGRGGPSSWIASLETNGPTSLEVSLCASPTAAVGRYLLKIH
IDPFQGSVTAYQLGFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGNKNWIRPCPW
NYGQFEDNIIDICLTLLDKSLHFQIDPATDCALRGSPVYVSRVVCAMINSNDDSGVLNGN
WSESYMDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITN
FDSGHDTDGNLIIDEYYDNTGRILKNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLDA
TPQETSNGLYCCGPASVRAIKGGEVDRKKEIERFAFSMVNADCVSWLVEGGKVQLHRDTS
FVGHFISTESQSDERDXXXXXXXXXXXTPQERQAFLKALQKVEARRSQGSLRAGSRPFRP
TPRSQEDPRSSLRPSDVVQVSLKFQLLGRPNMGQDIRFVLLALNVSSQSKDLKVNLSAQS
LLHDGSPLPPFWQDTAFITLSPQEAKTYPCTIPYSQYSQYLSTDKLIRISALGEEMSCPE
KILANKIITLSYPSITINVLGPAIVNEPLSIEVIFSNPLSEQVADCVLTVEGSGLFKKQQ
RVLIGVLKPQHRARVTLKTVPFKSGPRQIQANLRSDKFKDIKGYRNVYVDFGL
Download sequence
Identical sequences ENSMICP00000009103 ENSMICP00000009103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]