SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009165 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009165
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.11e-53
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000816
Further Details:      
 
Domain Number 2 Region: 183-286
Classification Level Classification E-value
Superfamily E set domains 1.35e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009165   Gene: ENSMICG00000010062   Transcript: ENSMICT00000010060
Sequence length 621
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1291:117484:156336:1 gene:ENSMICG00000010062 transcript:ENSMICT00000010060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGYNPYIEITEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNSRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFVQERRPLFFQNLGIRCVKKKEVKEAII
SRIKAGINPFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
PNTAELKICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAIMEPVTVKMQLRRPSDQEVSESMDFRYLPDEKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSNLFSHDAVLTEMPRSSGVSSQTESYYSSPVSISSGLSHHSSAXXXXXXXXXXXXXX
XXXXXVNTNPLHSFSTGTLSSNSQGISSFLEPVGSDLNASNTCIYNNSDDMGRMETSSMS
PADLYGISDANMLPNCPVNMMTTSNGSMGETDNLRLVSMNLENPTCNSVLDPRDLRQLHQ
MSPSSMSAGTSSNTTVFVSQSDAFEGSDFSCTDNSMINESGPSNSANTNSHSFVQSSQYS
SIGTMQNEQLGDSFAYEFFQV
Download sequence
Identical sequences ENSMICP00000009165 ENSMICP00000009165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]