SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009410 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009410
Domain Number 1 Region: 264-555
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-72
Family p120GAP domain-like 0.0000932
Further Details:      
 
Domain Number 2 Region: 112-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-32
Family Synaptotagmin-like (S variant) 0.0023
Further Details:      
 
Domain Number 3 Region: 7-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000156
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009410   Gene: ENSMICG00000010328   Transcript: ENSMICT00000010331
Sequence length 804
Comment pep:novel genescaffold:micMur1:GeneScaffold_2951:757325:783968:-1 gene:ENSMICG00000010328 transcript:ENSMICT00000010331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSSLSIRIVEGKNPPAKDXXXXXXXXXXXXXXXXXXXXTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYIMDEDALSRDDVIGKVCLTRDTLTSHPKGFSGWAHLTEVDPDEEVQGEI
HLQLEVVPGPRARRLRCSVLEARDLAPKDRNGASDPFVRVRYNGRTQETSIVKKSCYPRW
NETFEFELEERATEALCVEAWDWDLVSRNDFLGKVVVNVQGLRVAQQEEGWFRLQPDQSK
SRRDKGNLGSLQLEVRLRDEMVLPSGCYQPLVQLLCHEVKLGAQGPGQLIPFIEETTSTE
CRQDVATNLLKLFLGQGLAKDFLDLLFQLELRRTSEANTLFRSNSLASKSMESFLKVAGM
RYLHSIVGPIIDKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHLG
ALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIMS
PKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKD
FITKLVDIEEREELDLQRTLSLQAPPVKEGPLFIHRTKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXKSAFIRLVNIRAAEKVEEKSFGSSHVMQVIYTDDVGRPQTAYLQCKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWSCCHQRDRTDRGCDKTRSRVTLQEWNDPL
DHDLEAQLIYRHLLGVEPALREKLREPSRDTEAGAEPTGPDQAPEDPLAQLLQVLQDLRE
AHSCSSSPTSPPPSEPTRLLELQT
Download sequence
Identical sequences ENSMICP00000009410 ENSMICP00000009410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]