SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009443 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009443
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Globin-like 4.34e-24
Family Globins 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009443   Gene: ENSMICG00000010373   Transcript: ENSMICT00000010369
Sequence length 90
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2968:136389:137468:1 gene:ENSMICG00000010373 transcript:ENSMICT00000010369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIIVSMWGKISTQADAIGTETLERLFLSYPQTKTYFPHFDLHAGSAQLRAHGSKVVAAGD
AVKSIDNIAGALARLSELHAYILRDPVNFS
Download sequence
Identical sequences ENSMICP00000009443 ENSMICP00000009443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]