SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009454 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009454
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.75e-48
Family Globins 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009454   Gene: ENSMICG00000010387   Transcript: ENSMICT00000010382
Sequence length 142
Comment pep:novel genescaffold:micMur1:GeneScaffold_2968:141085:141779:1 gene:ENSMICG00000010387 transcript:ENSMICT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAADKNNIKAAWNAIGSHAGDHGAEALERMFHSFPTTKTYFSHFDMSHGSAQIKGHG
KKVADALGNAVNHLDDIPTALSALSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPAEFTP
AVHASLDKFFATVSTVLTSKYR
Download sequence
Identical sequences XP_012593221.2.48125 ENSMICP00000009454 ENSMICP00000009454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]