SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009534 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009534
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000187
Family Ribosomal protein L35ae 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009534   Gene: ENSMICG00000010472   Transcript: ENSMICT00000010469
Sequence length 106
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4773:35683:38896:1 gene:ENSMICG00000010472 transcript:ENSMICT00000010469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLYPSRI
Download sequence
Identical sequences ENSMICP00000009534 ENSMICP00000009534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]