SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009539 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009539
Domain Number 1 Region: 68-252
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009539   Gene: ENSMICG00000010478   Transcript: ENSMICT00000010474
Sequence length 697
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3184:20078:27786:-1 gene:ENSMICG00000010478 transcript:ENSMICT00000010474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDIKEHPLLASCESEDSICQFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCGENDTLPRPIQDILAILCLKGPSTEGIFRKAANEKARKELKEELNCGGAVDLE
RLPVHLLAAVFKDFLRSIPLKLLSSDLFEEWMGALETQDEEERXEALKQVAEKLPRPNLL
LLKHLVSVLYLISKNAEVSKMDASNLAICIGPNVLTLENDQNLSFEAQKDLNNKVKTVGE
FLIDNCYEIFGENIPVHSSITSDDSLEHTDSSDMSTLQNDSAYDSNDPDVESNSNSTVNS
PVGRPPGPTASAAGLDTRGPWDASESRPEPITSTVARLKGCLGQPDRRHSEPSMLSSQEC
LESQTTNPALTKSEDALPTPRSGSRLESEDAEDPFPEEVFPAGQGKTKRPVDLKIKNLTQ
GLVLPRGLVPKALSSGSLDRCSDSSPMASPSSPKRNFFTRHQSFSTKTEKSKPNREIKKH
SMSFSFASHKKVLTRRTPSTGKSQVFTRDQVTRGSKKESQLARVVQEDGSETLSPAALGC
SSRSCALWVDDVFQLAELGGPGSPPSYEEAVRCQAWEPAAYGSQTVGSMRARLLSQDPFL
PPVLPPPHREDSRDRCSGEPLAGHRLSPLTQHWAQSRTVSASVETLGHVAVPGRPELHRL
RTVSETVQKNKRDCLLRRCSQPMFEADQLQYVKESYI
Download sequence
Identical sequences ENSMICP00000009539 ENSMICP00000009539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]