SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009774 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009774
Domain Number 1 Region: 538-640
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.57e-41
Family PDEase 0.00016
Further Details:      
 
Domain Number 2 Region: 53-157
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-16
Family GAF domain 0.0057
Further Details:      
 
Domain Number 3 Region: 756-832
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000000897
Family PDEase 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000009774
Domain Number - Region: 241-279,306-368
Classification Level Classification E-value
Superfamily GAF domain-like 0.00393
Family GAF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009774   Gene: ENSMICG00000010725   Transcript: ENSMICT00000010727
Sequence length 835
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1874:9643:72657:1 gene:ENSMICG00000010725 transcript:ENSMICT00000010727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLREEQVRSFLDGNPDFARQYFGKKLSPENVAAACDNGRPTDCGSLRELCQVEEGAALF
ELVQDMQESINMERVVFKILRRLCTILRADRCSLFMYRQRNGVAELATRLFSVQPGSVLE
ECLVPPDSEIVFPLDIGVVGHVAQTKKMVNVQDVAEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGESQPY
SGPRTPDGREIVFYKVIDYILHGKEDITVIPXXXXXXXXXXXXXPTYVAESGFICNIMNA
SADEMFQFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRERLGKEPADC
EEDELGAILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVL
VRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDRNKAAELPKLQVGFIDFVCT
FVYKVSFSRFHEEILPMFERLQNNRKEWKALADEYEAKVKALEEKKKEEEQPTKK
Download sequence
Identical sequences ENSMICP00000009774 ENSMICP00000009774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]