SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009975 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009975
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.45e-59
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009975   Gene: ENSMICG00000010961   Transcript: ENSMICT00000010954
Sequence length 204
Comment pep:known_by_projection scaffold:micMur1:scaffold_5436:64084:84175:1 gene:ENSMICG00000010961 transcript:ENSMICT00000010954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQASCSAAAPLTERKFHVLVGVTGSVAALKLPLLVSRLLEIPGLEVAVVTTERAKHFY
SPQDVPVTLYSDADEWEMWKHRSDPVLHIDLRRWADFMLVAPLDANTLGKVASGICDNLL
TCVIRAWDRSKPLFFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDQGLGA
MAEVGTIVDKVKEVLSQHGGFQQN
Download sequence
Identical sequences ENSMICP00000009975 ENSMICP00000009975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]