SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010159 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010159
Domain Number 1 Region: 56-162
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 328-427
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 437-554
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 205-306
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010159   Gene: ENSMICG00000011154   Transcript: ENSMICT00000011154
Sequence length 778
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_896:15508:68586:-1 gene:ENSMICG00000011154 transcript:ENSMICT00000011154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLLGSGLCLCVAVLALLPCPSLAQYDGWPYYPEYFQQPAPEYHQPQVPADVVKIQLRL
AGQKRKHNEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASASYGKGEGP
IWLDNIHCTGKEATLAACSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINQVEVSH
SLNIQVEDIRIRAILSAFRNRAPVTEGYVEVKDGKHWKQLCDKHWTAKNSRVVCGMFGFP
AEKTYNAKVYKMYASRKKQRYWRYSMDCTGTEAHISSCKLGPPVSQGPMKNSTCANGLPA
VVSCVPGQVFSQDGPSRFRKAYKPEQPLVRLRGGASIGEGRVEVLKNGEWGTVCDDKWDL
VTASVVCRELGFGSAKEAVTGSRLGQGMGPIHLNEIECTGNEKSLIDCKFNAESQGCNHE
EDAGVRCNIPAMGFQKKVRLSGGRNPYEGRVEVLVERNGSLVWGTVCGENWGIVEAMVVC
RQLGLGFASNAFQETWYWHGNVFDNKVVMSGVKCSGTELSLAHCHHDDEEYVTCPQGGVQ
YGAGVACSETAPDLVLNAEIVQQTTYLEDRPMFMLQCAMEENCLSASAAKTDPTTGYRRL
LRFSSQIHNNGQADFRPKKGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASF
CLEDTECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVVINP
NFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLINNQLSPQ
Download sequence
Identical sequences ENSMICP00000010159 ENSMICP00000010159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]