SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010183 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000010183
Domain Number - Region: 13-45
Classification Level Classification E-value
Superfamily Elafin-like 0.00327
Family Elafin-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010183   Gene: ENSMICG00000011178   Transcript: ENSMICT00000011182
Sequence length 54
Comment pep:novel genescaffold:micMur1:GeneScaffold_3891:1181:1860:-1 gene:ENSMICG00000011178 transcript:ENSMICT00000011182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REMLLEECWGQPKVKECTRTCSRTLRCEDKNQKCCWSYCGNICWDENDKSLKDC
Download sequence
Identical sequences ENSMICP00000010183 ENSMICP00000010183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]