SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010283 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010283
Domain Number 1 Region: 159-261
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 259-363
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010283   Gene: ENSMICG00000011288   Transcript: ENSMICT00000011292
Sequence length 668
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3331:242464:284670:1 gene:ENSMICG00000011288 transcript:ENSMICT00000011292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFLVTAGSLTAALTGPLSPAPSGQPNTSTTETGPLEPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRALRLADGSGPCAGRVEMLQSG
QWAVCDDAWDLKDAHVVCRQLSCGAVQALPGLHFTPGREPIHRDQMNCSGAETHLWDCPG
LPGDHYCGHKEDAGVVCSEHQSWRLTGGADPCEGQVEVYFRGVWSTVCDSEWYSQEAEVL
CQTLGCGTTVEQPKGRPHTLAGRMYYSCKGREPTLSDCLWRFNNSNLCSQSLAARVLCSG
SRRLHNLSTPEGPASAQPVTVESSVTVKMDDTESLELMLLISCIVLGILLLASLIAIAFI
LLKVKGKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKLPMQVGAPAPEDSDSGS
DTDYEHYDFSAQPPVALTTFYNSQRHRVTDEEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXGPSADDSSSTSSGGEWYQNFQPPPPQPPSAEQFGCPGPPSPQPHSTDNE
DYDDIGAA
Download sequence
Identical sequences ENSMICP00000010283 ENSMICP00000010283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]