SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010578 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010578
Domain Number 1 Region: 3-513
Classification Level Classification E-value
Superfamily SIS domain 1.95e-223
Family Phosphoglucose isomerase, PGI 0.0000000000000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010578   Gene: ENSMICG00000011620   Transcript: ENSMICT00000011626
Sequence length 516
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_936:136196:158179:1 gene:ENSMICG00000011620 transcript:ENSMICT00000011626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLDTNHGHILVDYSKNLVTEDVMKMLVDLAKSRGVEAARENMFNGEKINHTENRAVLHV
ALRNRSNTPIVVDGKDVMPEVNRVLDKMKTFCQRVRSGDWKGYTGKAITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWFVSNIDGTHIAKTLTNLNPESSLFIIASKTFTTQETITN
AETAKEWFLLSAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIG
LSIALHVGFDNFEQLLSGAHWMDQHFRTAPLEKNAPVLLALLGIWYINFFGCETHAMLPY
DQYMHRFAAYFQQGDMESNGKYITKSGIRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKSVEEARKELHVAGKSPEELEK
LLPHKVFEGNRPTNSIMFTKLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQL
AKKIEPELDGNAPVTSHDSSTNGLISFIKQHREARI
Download sequence
Identical sequences ENSMICP00000010578 ENSMICP00000010578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]