SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010579 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010579
Domain Number 1 Region: 38-212
Classification Level Classification E-value
Superfamily Lysozyme-like 1.17e-25
Family G-type lysozyme 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010579   Gene: ENSMICG00000011632   Transcript: ENSMICT00000011627
Sequence length 212
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1991:158101:167313:-1 gene:ENSMICG00000011632 transcript:ENSMICT00000011627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVMFWGLIALIGTSRGSYPFTQSMSPHLQPRLYRGCYGDIMTMETSGAACDINSLIS
CGIRGSEMFAEMDLRAIKPYQTVIKEVGQRHCVDPAIIAAIISRESHGGSILRDGWDHRG
LKFGLMQLDKQIYHPVGTWDSKEHLLQAVGVLTDRIKAIQKKFPTWNATQHLKGGLSAFR
SGIEAIGAPEDIDNDYVNDVLARARFYRRQGY
Download sequence
Identical sequences ENSMICP00000010579 ENSMICP00000010579 XP_020141864.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]