SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010682 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010682
Domain Number 1 Region: 191-501
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.71e-100
Family Transglutaminase core 0.000000000105
Further Details:      
 
Domain Number 2 Region: 636-726
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-24
Family Transglutaminase, two C-terminal domains 0.00000509
Further Details:      
 
Domain Number 3 Region: 96-190
Classification Level Classification E-value
Superfamily E set domains 6.3e-24
Family Transglutaminase N-terminal domain 0.00000401
Further Details:      
 
Domain Number 4 Region: 516-583
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.96e-18
Family Transglutaminase, two C-terminal domains 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010682   Gene: ENSMICG00000011731   Transcript: ENSMICT00000011735
Sequence length 731
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1576:32529:193405:-1 gene:ENSMICG00000011731 transcript:ENSMICT00000011735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSTPAFGGRRAVPPNTSNAEEDDLPTVEMQALVPRGVSLQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDLFRVEYVIGRYPQENKGTYIPV
PVVPELQSGKWGAKVVMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTSRNPETD
TYLLNPWCEEDAVYLDNEKERDEYVLSDIGVIFYGDVNETKSRSWSYGQFEDGILDACLY
VMDKAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDILL
EYKSSANPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGNV
NSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVNSDLVYITAKKDGTHVVEAVDATHIGKLIVTKEIGGDGMKDITDT
YKFQEGQEEERLALETALMYGAKKPLNTEGVVKPRSNVDMDFEVENAVLGKDFKLSITFQ
NNSSSRYTISAYLSGSITFYTGVAKAEFKKETFEVTLEPLSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGAKVVGSDMVVTVEFTNPLKETL
RNVWLYLDGPGILRPRRKMFREIRPNATVQWEEVCRPWVSGPRKLIASMTSDSLRHVYGE
LDLHIQRRPSV
Download sequence
Identical sequences ENSMICP00000010682 ENSMICP00000010682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]