SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010737 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010737
Domain Number 1 Region: 44-223
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.73e-64
Family Brix domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010737   Gene: ENSMICG00000011797   Transcript: ENSMICT00000011792
Sequence length 253
Comment pep:novel scaffold:micMur1:scaffold_19404:6851:8697:-1 gene:ENSMICG00000011797 transcript:ENSMICT00000011792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRLIPTELRREALALQGSVEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLK
MFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVIHEHRGTPVGLIVSHLPFGP
TAYFTLCNVVMRHDIPNLGTISEAKPHLITHGFSSRLGKRVSDILRYLFPVPKDDSHRVI
TFANQDDYISFRHHVYKKIDRRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPY
TNTARKRVFLSAE
Download sequence
Identical sequences ENSMICP00000010737 ENSMICP00000010737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]