SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010860 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010860
Domain Number 1 Region: 112-358
Classification Level Classification E-value
Superfamily L domain-like 4.25e-43
Family Ngr ectodomain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 410-713
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-42
Family Rhodopsin-like 0.00042
Further Details:      
 
Domain Number 3 Region: 40-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010860   Gene: ENSMICG00000011921   Transcript: ENSMICT00000011928
Sequence length 753
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1468:535861:590167:1 gene:ENSMICG00000011921 transcript:ENSMICT00000011928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVIFLVKHHFSLRFIAMFFLLHFIVLVDVKDFVLTEGSTITPLCQKGYFPCGNLTKCLPR
AFHCDGEDDCGNGADEENCGDTSGWATIFGTVHRNANNMALTQECFLNQYPPRCDCKETE
LECVNAGLKSVPRISSNVTLLSLKKNKIHSLPDKVFIKYTKVKKIFLQHNCIRHISRKAF
FGLFNLQILYLNHNCITTLRPGVFQDLYQLTWLILDNNSITRISQRLFTGLNSLFFLSMV
NNYLEALPKQMCTQMPQLNWXXXXXXXXXXXXXXXXXXXXXLTVLFLPRNQIDFVPEKTF
SSLKNLGELDLSSNMIMELPPHLFKDLKLLQKLNLSSNPLLDLHKNQFESLKQLQSLXXX
XXXXXXXXXXXXXXXXXXXXXYFKNFRYCSYVPHVRICMPLTDGISSFEDLLANNILRIF
VWVIAFITCFGNLFVIGMRSFIKAENTTHTMSIKLLCCADCLMGVYLFFVGFFDIKYRGQ
YQKYALLWMESLQCRLMGFLAMLSAEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTLVI
LICIWMVGFLIAVIPFWNEDYFGNFYGKNGVCFPLYYDQTEDTGGKGYSLGIFLGVNLLA
FLIIVFSYITMFCSIQKTALQTAEVRNHIGREVAVANRFFFIVFSDAICWIPVFVIKILS
LFRVEIPGTITSWIVIFFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKSIFTIKKKS
LSISIVWTDDSSSLKLGVLNKITLGDSVMKPVS
Download sequence
Identical sequences ENSMICP00000010860 ENSMICP00000010860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]